Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronavirus HKU1 Non-structural protein 4 protein

This coronavirus HKU1 Non-structural protein 4 protein spans the amino acid sequence from region 1-109aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

UniProt

Q5MQC9

Expression Region

1-109aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD74 Protein
B2011889 100 µg

Human CD74 Protein

Sign In for Pricing
View Details
Mouse Fut8 (NM_001252614) AAV Particle
MR230559A1V 250 µL

Mouse Fut8 (NM_001252614) AAV Particle

Sign In for Pricing
View Details
SSTR1 Antibody
OAAL00316-100UG 100 µg

SSTR1 Antibody

Sign In for Pricing
View Details
Recombinant Anti-His-Tag Monoclonal Antibody
TBS10221-5 5 mg

Recombinant Anti-His-Tag Monoclonal Antibody

Sign In for Pricing
View Details
CNE1 Antibody
orb844760 2 mg

CNE1 Antibody

Sign In for Pricing
View Details
Aprutumab (Reference antibody)
E55B0475 100 µg

Aprutumab (Reference antibody)

Sign In for Pricing
View Details