Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRA2 protein

This GRA2 protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

28 kDa antigen GP28.5

UniProt

P13404

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Toxoplasma gondii

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQQEPEEPVSQRASRVAEQLFRKFLKFAENVGHHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANVESDRSTTTTQAPDSPNGLAETEVPVEPQQRAAHVPVPDFSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: LBI3G1]
AMM21252V 100 µL

Syndecan 1 (SDC1) Mouse Monoclonal Antibody [Clone ID: LBI3G1]

Sign In for Pricing
View Details
Sufu (NM_001024899) Rat Tagged Lenti ORF Clone
RR210578L3 10 µg

Sufu (NM_001024899) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HCG (5B8), mAb, Mouse
V07002-10 10 mg

HCG (5B8), mAb, Mouse

Sign In for Pricing
View Details
PLV3-U6-ANGPTL4-shRNA5-CopGFP-Puro Plasmid
PVT74324 2 µg

PLV3-U6-ANGPTL4-shRNA5-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
B3GNTL1 (NM_001009905) Human Tagged ORF Clone Lentiviral Particle
RC215480L4V 200 µL

B3GNTL1 (NM_001009905) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human UDP-glucuronosyltransferase 2B15, UGT2B15 ELISA Kit
MBS9337061-01 48 Well

Human UDP-glucuronosyltransferase 2B15, UGT2B15 ELISA Kit

Sign In for Pricing
View Details