Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRA2 protein

This GRA2 protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

28 kDa antigen GP28.5

UniProt

P13404

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Toxoplasma gondii

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQQEPEEPVSQRASRVAEQLFRKFLKFAENVGHHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANVESDRSTTTTQAPDSPNGLAETEVPVEPQQRAAHVPVPDFSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf19 Antibody - N-terminal region
ARP42513_P050-25UL 25 µL

C4orf19 Antibody - N-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal IL-22 Antibody [Alexa Fluor 594]
NBP2-41245AF594 0.1 mL

Rabbit Polyclonal IL-22 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
CDH10 Antibody (C-term)
MBS9205843-01 0.08 mL

CDH10 Antibody (C-term)

Sign In for Pricing
View Details
CDH10 Antibody (C-term)
MBS9205843-02 0.4 mL

CDH10 Antibody (C-term)

Sign In for Pricing
View Details
CDH10 Antibody (C-term)
MBS9205843-03 5x 0.4 mL

CDH10 Antibody (C-term)

Sign In for Pricing
View Details
Anti-SLC4A1/CD233/Band 3 Antibody Picoband® (PE Conjugate)
PB9437-PE 100 µg/Vial

Anti-SLC4A1/CD233/Band 3 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details