Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCDC112 protein

This Human CCDC112 protein spans the amino acid sequence from region 73-227aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mutated in bladder cancer protein 1

UniProt

Q8NEF3

Expression Region

73-227aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

REMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEEVLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKGKPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Robo4 ORF Vector (Rat) (pORF)
ORF075502 1.0 µg DNA

Robo4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TRPM7 Rabbit Polyclonal Antibody (Biotin)
orb2610716 100 µg

TRPM7 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit
MBS267332-01 48 Well

Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit
MBS267332-02 96 Well

Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit
MBS267332-03 5x 96 Well

Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit

Sign In for Pricing
View Details
Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit
MBS267332-04 10x 96 Well

Porcine Heat Shock Transcription Factor 1 (HSF1) ELISA Kit

Sign In for Pricing
View Details