Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H3A protein

This Human HIST1H3A protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3/a (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l) (H3FAAND)

UniProt

P68431

Expression Region

2-136aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgA2 Isotype Control Antibody (13R4)
MBS1564542-01 0.1 mg

Human IgA2 Isotype Control Antibody (13R4)

Sign In for Pricing
View Details
Human IgA2 Isotype Control Antibody (13R4)
MBS1564542-02 1 mg

Human IgA2 Isotype Control Antibody (13R4)

Sign In for Pricing
View Details
Human IgA2 Isotype Control Antibody (13R4)
MBS1564542-03 5x 1 mg

Human IgA2 Isotype Control Antibody (13R4)

Sign In for Pricing
View Details
GEFT AAV Vector (Human) (CMV)
21435101 1 µg

GEFT AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
POLDIP1 (KCTD13) (NM_178863) Human Over-expression Lysate
LH15680V 100 µg

POLDIP1 (KCTD13) (NM_178863) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Cyanophenyl trifluoromethanesulfonate
PC1001657-01 100 mg

2-Cyanophenyl trifluoromethanesulfonate

Sign In for Pricing
View Details