Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Firefly Pcmt protein

This Firefly Pcmt protein spans the amino acid sequence from region 1-226aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-isoaspartyl protein carboxyl methyltransferase Protein L-isoaspartyl/D-aspartyl methyltransferase Protein-beta-aspartate methyltransferase dPIMT

UniProt

Q27869

Expression Region

1-226aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF488A conjugate, 0.1mg/mL
BNC882570-500 1x 500 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRIFIN CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22663154 3x 1.0 µg DNA

GRIFIN CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Albumin Fraction V (pH 7.0) for molecular biology
1126GR100 100 g

Albumin Fraction V (pH 7.0) for molecular biology

Sign In for Pricing
View Details
Lys-63-Specific Deubiquitinase BRCC36 (BRCC3) Antibody (Biotin)
abx105631-01 20 µg

Lys-63-Specific Deubiquitinase BRCC36 (BRCC3) Antibody (Biotin)

Sign In for Pricing
View Details
Lys-63-Specific Deubiquitinase BRCC36 (BRCC3) Antibody (Biotin)
abx105631-02 50 µg

Lys-63-Specific Deubiquitinase BRCC36 (BRCC3) Antibody (Biotin)

Sign In for Pricing
View Details
Lys-63-Specific Deubiquitinase BRCC36 (BRCC3) Antibody (Biotin)
abx105631-03 100 µg

Lys-63-Specific Deubiquitinase BRCC36 (BRCC3) Antibody (Biotin)

Sign In for Pricing
View Details