Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Firefly Pcmt protein

This Firefly Pcmt protein spans the amino acid sequence from region 1-226aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-isoaspartyl protein carboxyl methyltransferase Protein L-isoaspartyl/D-aspartyl methyltransferase Protein-beta-aspartate methyltransferase dPIMT

UniProt

Q27869

Expression Region

1-226aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Transforming growth factor beta receptor 3 (TGFBR3) ELISA
KBH6301 1x 96 Well

GENLISA™ Human Transforming growth factor beta receptor 3 (TGFBR3) ELISA

Sign In for Pricing
View Details
EGFL6 CRISPR Activation Plasmid (m2)
sc-424803-ACT-2 20 µg

EGFL6 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
IL2RA Antibody (HRP)
orb400861-01 50 µg

IL2RA Antibody (HRP)

Sign In for Pricing
View Details
IL2RA Antibody (HRP)
orb400861-02 100 µg

IL2RA Antibody (HRP)

Sign In for Pricing
View Details
PGC (Pepsinogen C) BioAssayTM ELISA Kit (Human) discontinued
384039 96 Tests

PGC (Pepsinogen C) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Mouse fibroblast growth factor-23, FGF-23 ELISA Kit
YLA0390MO-01 48 Tests

Mouse fibroblast growth factor-23, FGF-23 ELISA Kit

Sign In for Pricing
View Details