Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla protein

This bla protein spans the amino acid sequence from region 29-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cefotaximase 2

UniProt

P74841

Expression Region

29-291aa

Tag

Tag-Free

Source

E.coli

Origin

Salmonella typhimurium

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QANSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAESRRDILAAAAKIVTHGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC18A Protein Vector (Mouse) (pPB-C-His)
PV166094 500 ng

CLEC18A Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
AMA1 protein
30-1388 0.5 mg

AMA1 protein

Sign In for Pricing
View Details
BNC1 polyclonal antibody
BS60049-01 50 µL

BNC1 polyclonal antibody

Sign In for Pricing
View Details
BNC1 polyclonal antibody
BS60049-02 100 µL

BNC1 polyclonal antibody

Sign In for Pricing
View Details
Human Calponin-1, CNN1 ELISA Kit
MBS700897-01 24 Well (LIMIT 1)

Human Calponin-1, CNN1 ELISA Kit

Sign In for Pricing
View Details
Human Calponin-1, CNN1 ELISA Kit
MBS700897-02 48 Well

Human Calponin-1, CNN1 ELISA Kit

Sign In for Pricing
View Details