Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Atf4 protein

This Rat Atf4 protein spans the amino acid sequence from region 1-347aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activating transcription factor 4

UniProt

Q9ES19

Expression Region

1-347aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPUSD3 (NM_173659) Human Over-expression Lysate
LS285367-20ug 20 µg

RPUSD3 (NM_173659) Human Over-expression Lysate

Sign In for Pricing
View Details
USP2 (Ubiquitin-specific Processing Protease 2, UBP41, Ubiquitin Specific Peptidase 2, USP9) discontinued
339176 100 µL

USP2 (Ubiquitin-specific Processing Protease 2, UBP41, Ubiquitin Specific Peptidase 2, USP9) discontinued

Sign In for Pricing
View Details
CBR4 Protein Vector (Human) (pPB-C-His)
PV007637 500 ng

CBR4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
DL-serine methyl ester
BI12123 1 Each

DL-serine methyl ester

Sign In for Pricing
View Details
Mouse CD200R1 ELISA Kit
orb526876 96 Tests

Mouse CD200R1 ELISA Kit

Sign In for Pricing
View Details
PSA Recombinant Rabbit mAb, APC-Cy5.5 conjugated
orb3124997 100 µL

PSA Recombinant Rabbit mAb, APC-Cy5.5 conjugated

Sign In for Pricing
View Details