Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronavirus OC43 Spike glycoprotein protein

This coronavirus OC43 Spike glycoprotein protein spans the amino acid sequence from region 318-624aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E2 Peplomer protein

UniProt

P36334

Expression Region

318-624aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TVQPIADVYRRKPNLPNCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNKRFGFIEDSVFKPRPAGVLTNHDVVYAQHCFKAPKNFCPCKLNGSCVGSGPGKNNGIGTCPAGTNYLTCDNLCTPDPITFTGTYKCPQTKSLVGIGEHCSGLAVKSDYCGGNSCTCRPQAFLGWSADSCLQGDKCNIFANFILHDVNSGLTCSTDLQKANTDIILGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SNAP25 Antibody Picoband®, Dylight594 Conjugate
PA1315-Dylight594 100 µg

Anti-SNAP25 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)
MBS2049408-01 0.1 mL

APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)
MBS2049408-02 0.2 mL

APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)
MBS2049408-03 0.5 mL

APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)
MBS2049408-04 1 mL

APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)
MBS2049408-05 5 mL

APC-Linked Polyclonal Antibody to Prostaglandin E Synthase 2 (PTGES2)

Sign In for Pricing
View Details