Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human coronavirus 229E Nucleo protein

This Human coronavirus 229E Nucleo protein spans the amino acid sequence from region 1-389aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P15130

Expression Region

1-389aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Human coronavirus 229E (HCoV-229E)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF2 Antibody, FITC conjugated
A41921-50UG 50 µg

CSF2 Antibody, FITC conjugated

Sign In for Pricing
View Details
ADCY7 Rabbit pAb, IRDye 800CW conjugated
orb2842781 100 µL

ADCY7 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
3-Benzyl-6-bromo-1H-quinolin-2-one
TYD-03666-01 10 mg

3-Benzyl-6-bromo-1H-quinolin-2-one

Sign In for Pricing
View Details
3-Benzyl-6-bromo-1H-quinolin-2-one
TYD-03666-02 50 mg

3-Benzyl-6-bromo-1H-quinolin-2-one

Sign In for Pricing
View Details
Canine Antigen KI-67,MKI67 ELISA KIT
JOT-EK0449Ca-01 96 Well

Canine Antigen KI-67,MKI67 ELISA KIT

Sign In for Pricing
View Details
Canine Antigen KI-67,MKI67 ELISA KIT
JOT-EK0449Ca-02 48 Well

Canine Antigen KI-67,MKI67 ELISA KIT

Sign In for Pricing
View Details