Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronavirus OC43 Nucleo protein

This coronavirus OC43 Nucleo protein spans the amino acid sequence from region 1-448aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P33469

Expression Region

1-448aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab 10 (10W13) Rabbit Monoclonal Antibody
E28G2738 100 µL

Rab 10 (10W13) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PAX6 (AN2, Paired Box Protein Pax-6, Aniridia Type II Protein, Oculorhombin, MGC17209) (MaxLight 405)
MBS6388541-01 0.1 mL

PAX6 (AN2, Paired Box Protein Pax-6, Aniridia Type II Protein, Oculorhombin, MGC17209) (MaxLight 405)

Sign In for Pricing
View Details
PAX6 (AN2, Paired Box Protein Pax-6, Aniridia Type II Protein, Oculorhombin, MGC17209) (MaxLight 405)
MBS6388541-02 5x 0.1 mL

PAX6 (AN2, Paired Box Protein Pax-6, Aniridia Type II Protein, Oculorhombin, MGC17209) (MaxLight 405)

Sign In for Pricing
View Details
GLI-1 Polyclonal Antibody
E11-2036073 100 µg -100 µL

GLI-1 Polyclonal Antibody

Sign In for Pricing
View Details
A549 Whole Cell RIPA Extract
SQDB-110411-01 100 µg

A549 Whole Cell RIPA Extract

Sign In for Pricing
View Details
A549 Whole Cell RIPA Extract
SQDB-110411-02 500 µg

A549 Whole Cell RIPA Extract

Sign In for Pricing
View Details