Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronavirus OC43 Spike glycoprotein protein

This coronavirus OC43 Spike glycoprotein protein spans the amino acid sequence from region 15-344aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E2; Peplomer protein

UniProt

P36334

Expression Region

15-344aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: rectosigmoid
CR559393 5 µg

Tissue Total RNA, Colon: rectosigmoid

Sign In for Pricing
View Details
Rpl17 Mouse Gene Knockout Kit (CRISPR)
KN515020 1 Kit

Rpl17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TYW1B Human Gene Knockout Kit (CRISPR)
KN427249 1 Kit

TYW1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,2'-Dibromobiphenyl
TRC-D425558-5G 5 g

2,2'-Dibromobiphenyl

Sign In for Pricing
View Details
Eg5 (KIF11) (NM_004523) Human Recombinant Protein
TP318842M 100 µg

Eg5 (KIF11) (NM_004523) Human Recombinant Protein

Sign In for Pricing
View Details
TrueBlack® Plus Lipofuscin Autofluorescence Quencher, 40X in DMSO (trial size)
#23014-T 1x 50 µL

TrueBlack® Plus Lipofuscin Autofluorescence Quencher, 40X in DMSO (trial size)

Sign In for Pricing
View Details