Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronavirus OC43 Spike glycoprotein protein

This coronavirus OC43 Spike glycoprotein protein spans the amino acid sequence from region 15-344aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E2; Peplomer protein

UniProt

P36334

Expression Region

15-344aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzylidene Camphor Sulfonic Acid
TRC-B280038-50MG 50 mg

Benzylidene Camphor Sulfonic Acid

Sign In for Pricing
View Details
B3GAT2 (Center) Rabbit Polyclonal Antibody
AP50326PU-N 400 µL

B3GAT2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2R,3R)-Bis(diphenylphosphino)butane
TRC-B430380-25MG 25 mg

(2R,3R)-Bis(diphenylphosphino)butane

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS803797 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
ABP1 (AOC1) (NM_001091) Human Recombinant Protein
TP304163L 1 mg

ABP1 (AOC1) (NM_001091) Human Recombinant Protein

Sign In for Pricing
View Details
IFNB1 Polyclonal Antibody
E-AB-19507-01 20 µL

IFNB1 Polyclonal Antibody

Sign In for Pricing
View Details