Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Metapneumovirus Matrix protein protein

This metapneumovirus Matrix protein protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6WB99

Expression Region

1-254aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human metapneumovirus (strain CAN97-83) (HMPV)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESYLVDTYQGIPYTAAVQVDLVEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQSGPILKVNASAQGAAMSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSKFVSSAKPVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVSIKESESATVEAAISSEADQALTQAKIAPYAGLIMIMTMNNPKGIFKKLGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calprotectin (S100a9) Mouse shRNA Lentiviral Particle (Locus ID 20202)
TL514212V 500 µL Each

Calprotectin (S100a9) Mouse shRNA Lentiviral Particle (Locus ID 20202)

Sign In for Pricing
View Details
Anti-SYVN1 (4H4)
YF-MA20594 200 ul

Anti-SYVN1 (4H4)

Sign In for Pricing
View Details
FGF23 Protein Vector (Human) (pPM-C-HA)
PV016151 500 ng

FGF23 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-MGME1 Antibody Picoband®, PE Conjugate
A09360-1-PE 100 µg/Vial

Anti-MGME1 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Pan-CEA Antibody Cocktail / CEACAM5
V2450-20UG 20 µg

Pan-CEA Antibody Cocktail / CEACAM5

Sign In for Pricing
View Details
Human TEM1 / Endosialin / CD248, His Tag
E24PHA465 50 µg

Human TEM1 / Endosialin / CD248, His Tag

Sign In for Pricing
View Details