Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARHGEF12 protein

This Human ARHGEF12 protein spans the amino acid sequence from region 367-558aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leukemia-associated RhoGEF

UniProt

Q9NZN5

Expression Region

367-558aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3TC2 Antibody
8C18715-AAT 50 µg

SH3TC2 Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL-21 protein (His Tag)
PKSM041469-01 20 µg

Recombinant Mouse IL-21 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-21 protein (His Tag)
PKSM041469-02 100 µg

Recombinant Mouse IL-21 protein (His Tag)

Sign In for Pricing
View Details
(Z)-Chlorolefin-13C6
TRC-C365781-1MG 1 mg

(Z)-Chlorolefin-13C6

Sign In for Pricing
View Details
Human TMEM179 activation kit by CRISPRa
GA117927 1 Kit

Human TMEM179 activation kit by CRISPRa

Sign In for Pricing
View Details
Apolipoprotein D (APOD) Rabbit Polyclonal Antibody
TA372120 100 µL

Apolipoprotein D (APOD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details