Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARHGEF12 protein

This Human ARHGEF12 protein spans the amino acid sequence from region 367-558aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leukemia-associated RhoGEF

UniProt

Q9NZN5

Expression Region

367-558aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp735 Protein Vector (Mouse) (pPB-N-His)
PV250139 500 ng

Zfp735 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse CD63 antigen (CD63) ELISA Kit
AE51317MO-01 48 Tests

Mouse CD63 antigen (CD63) ELISA Kit

Sign In for Pricing
View Details
Mouse CD63 antigen (CD63) ELISA Kit
AE51317MO-02 96 Tests

Mouse CD63 antigen (CD63) ELISA Kit

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD9 Antibody
JOT22613F 20Tests

PE/Cyanine5 Anti-Human CD9 Antibody

Sign In for Pricing
View Details
DLG5 (NM_004747) Human Over-expression Lysate
LS009231-20ug 20 µg

DLG5 (NM_004747) Human Over-expression Lysate

Sign In for Pricing
View Details
PDK3 Knockout MES-OV Polyclonal Cells
ARG6824 1 Million

PDK3 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details