Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YafQ protein

This yafQ protein spans the amino acid sequence from region 1-102aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P44041

Expression Region

1-102aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYVIQDEFDELKFSRLNIHSQTALK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TCL1B Antibody
A13545 100 µL

Anti-TCL1B Antibody

Sign In for Pricing
View Details
Mavs Rabbit Polyclonal Antibody (PE)
orb2596643 100 µg

Mavs Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal Trimethyl-Histone H3 (Lys9) Antibody (Human)
B2024495 200 µL

Rabbit Polyclonal Trimethyl-Histone H3 (Lys9) Antibody (Human)

Sign In for Pricing
View Details
Recombinant Rhizobium meliloti PhaF2 protein (phaF2)
MBS7026156-01 0.02 mg

Recombinant Rhizobium meliloti PhaF2 protein (phaF2)

Sign In for Pricing
View Details
Recombinant Rhizobium meliloti PhaF2 protein (phaF2)
MBS7026156-02 0.1 mg

Recombinant Rhizobium meliloti PhaF2 protein (phaF2)

Sign In for Pricing
View Details
Recombinant Rhizobium meliloti PhaF2 protein (phaF2)
MBS7026156-03 5x 0.1 mg

Recombinant Rhizobium meliloti PhaF2 protein (phaF2)

Sign In for Pricing
View Details