Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DCAF7 protein

This Human DCAF7 protein spans the amino acid sequence from region 1-342aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WD repeat-containing protein 68 WD repeat-containing protein An11 homolog

UniProt

P61962

Expression Region

1-342aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Temozolomide
ALX-420-044-M100 100 mg

Temozolomide

Sign In for Pricing
View Details
PKCbeta1 Antibody
orb2807014 100 µL

PKCbeta1 Antibody

Sign In for Pricing
View Details
PAI-1 Biosimilar (Sanofi patent SERPINE1 Reference Antibody)
orb2702795-01 1 mg

PAI-1 Biosimilar (Sanofi patent SERPINE1 Reference Antibody)

Sign In for Pricing
View Details
PAI-1 Biosimilar (Sanofi patent SERPINE1 Reference Antibody)
orb2702795-02 5 mg

PAI-1 Biosimilar (Sanofi patent SERPINE1 Reference Antibody)

Sign In for Pricing
View Details
PAI-1 Biosimilar (Sanofi patent SERPINE1 Reference Antibody)
orb2702795-03 100 mg

PAI-1 Biosimilar (Sanofi patent SERPINE1 Reference Antibody)

Sign In for Pricing
View Details
L-Anserine nitrate salt
C09254-01 25 mg

L-Anserine nitrate salt

Sign In for Pricing
View Details