Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NOTCH2NLB protein

This Human NOTCH2NLB protein spans the amino acid sequence from region 26-275aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P0DPK3

Expression Region

26-275aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-SRC-sgRNA1-Cas9-puro Plasmid
PVT73796 2 µg

PLV3-U6-SRC-sgRNA1-Cas9-puro Plasmid

Sign In for Pricing
View Details
Nori® Bovine MMP-8 ELISA Kit
GR112199 96 Well

Nori® Bovine MMP-8 ELISA Kit

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)
MBS1241695-01 0.02 mg (E-Coli)

Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)
MBS1241695-02 0.1 mg (E-Coli)

Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)
MBS1241695-03 0.02 mg (Yeast)

Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details
Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)
MBS1241695-04 0.1 mg (Yeast)

Recombinant Gemmatimonas aurantiaca Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details