Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP74A protein

This CYP74A protein spans the amino acid sequence from region 34-518aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome P450 74A Hydroperoxide dehydrase

UniProt

Q96242

Expression Region

34-518aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGSETPDLTVATRTGSKDLPIRNIPGNYGLPIVGPIKDRWDYFYDQGAEEFFKSRIRKYNSTVYRVNMPPGAFIAENPQVVALLDGKSFPVLFDVDKVEKKDLFTGTYMPSTELTGGYRILSYLDPSEPKHEKLKNLLFFLLKSSRNRIFPEFQATYSELFDSLEKELSLKGKADFGGSSDGTAFNFLARAFYGTNPADTKLKADAPGLITKWVLFNLHPLLSIGLPRVIEEPLIHTFSLPPALVKSDYQRLYEFFLESAGEILVEADKLGISREEATHNLLFATCFNTWGGMKILFPNMVKRIGRAGHQVHNRLAEEIRSVIKSNGGELTMGAIEKMELTKSVVYECLRFEPPVTAQYGRAKKDLVIESHDAAFKVKAGEMLYGYQPLATRDPKIFDRADEFVPERFVGEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRRYDSFDIEVGTSPLGSSVNFSSLRKASF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPHN1 Rabbit Polyclonal Antibody (HRP)
orb476685 100 µL

LPHN1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FAM216A (Chromosome 12 Open Reading Frame 24, Protein FAM216A, C12orf24) (MaxLight 550)
MBS6378060-01 0.1 mL

FAM216A (Chromosome 12 Open Reading Frame 24, Protein FAM216A, C12orf24) (MaxLight 550)

Sign In for Pricing
View Details
FAM216A (Chromosome 12 Open Reading Frame 24, Protein FAM216A, C12orf24) (MaxLight 550)
MBS6378060-02 5x 0.1 mL

FAM216A (Chromosome 12 Open Reading Frame 24, Protein FAM216A, C12orf24) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7226875-01 48 Well

Mouse Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details
Mouse Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7226875-02 96 Well

Mouse Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details
Mouse Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7226875-03 5x 96 Well

Mouse Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details