Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP9 protein

This Human PARP9 protein spans the amino acid sequence from region 628-854aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 9 B aggressive lymphoma protein Poly [ADP-ribose] polymerase 9

UniProt

Q8IXQ6

Expression Region

628-854aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha B Crystallin Antibody
MBS801110-01 0.05 mg

Alpha B Crystallin Antibody

Sign In for Pricing
View Details
Alpha B Crystallin Antibody
MBS801110-02 0.2 mg

Alpha B Crystallin Antibody

Sign In for Pricing
View Details
Lentiviral human PHOSPHO2 shRNA (UAS) - Lentiviral human PHOSPHO2 shRNA (UAS) (100)
GTR15137190 1 Vial

Lentiviral human PHOSPHO2 shRNA (UAS) - Lentiviral human PHOSPHO2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Escherichia coli FMN reductase (NADH) RutF
MBS1146797-01 0.02 mg (E-Coli)

Recombinant Escherichia coli FMN reductase (NADH) RutF

Sign In for Pricing
View Details
Recombinant Escherichia coli FMN reductase (NADH) RutF
MBS1146797-02 0.1 mg (E-Coli)

Recombinant Escherichia coli FMN reductase (NADH) RutF

Sign In for Pricing
View Details
Recombinant Escherichia coli FMN reductase (NADH) RutF
MBS1146797-03 0.02 mg (Yeast)

Recombinant Escherichia coli FMN reductase (NADH) RutF

Sign In for Pricing
View Details