Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Herpesvirus 6A Envelope glycoprotein B protein

This herpesvirus 6A Envelope glycoprotein B protein spans the amino acid sequence from region 23-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P28864

Expression Region

23-188aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRE (N-term) Rabbit Polyclonal Antibody
E10G31464 100 µL

PTPRE (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-COPS4 Rabbit Monoclonal Antibody
M09585 100 µL/Vial

Anti-COPS4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CDKN2A / p16INK4a / p14ARF; Clone CDKN2A/4499
RA1093-C1 1 mL

CDKN2A / p16INK4a / p14ARF; Clone CDKN2A/4499

Sign In for Pricing
View Details
Nceh1 (NM_178772) Mouse Tagged ORF Clone
MR206408 10 µg

Nceh1 (NM_178772) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MK6-83-d10
456324-01 1 mg

MK6-83-d10

Sign In for Pricing
View Details
MK6-83-d10
456324-02 10 mg

MK6-83-d10

Sign In for Pricing
View Details