Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Herpesvirus 6A Envelope glycoprotein B protein

This herpesvirus 6A Envelope glycoprotein B protein spans the amino acid sequence from region 23-188aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P28864

Expression Region

23-188aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-bromo dibenzofuran d7
JH914838 1 Each

1-bromo dibenzofuran d7

Sign In for Pricing
View Details
Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit
MBS7215106-01 48 Well

Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit
MBS7215106-02 96 Well

Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit
MBS7215106-03 5x 96 Well

Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit
MBS7215106-04 10x 96 Well

Rat Cysteine-rich motor neuron 1 protein (CRIM1) ELISA Kit

Sign In for Pricing
View Details
Bpi Mouse qPCR Primer Pair (NM_177850)
MP201197 200 Reactions

Bpi Mouse qPCR Primer Pair (NM_177850)

Sign In for Pricing
View Details