Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lassa virus RING finger protein Z protein

This Lassa virus RING finger protein Z protein spans the amino acid sequence from region 2-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc-binding protein

UniProt

O73557

Expression Region

2-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Peptide (MaxLight 405)
MBS6188245-01 0.1 mL

C-Peptide (MaxLight 405)

Sign In for Pricing
View Details
C-Peptide (MaxLight 405)
MBS6188245-02 5x 0.1 mL

C-Peptide (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Anti Human DHFR Monoclonal Clone ACBE-4 100UL
IRBAHUDHFRACBE4C100UL 100 µL

Rabbit Anti Human DHFR Monoclonal Clone ACBE-4 100UL

Sign In for Pricing
View Details
ZNF565 (NM_001042474) Human Over-expression Lysate
LH05149V 100 µg

ZNF565 (NM_001042474) Human Over-expression Lysate

Sign In for Pricing
View Details
IFI27L1 Over-expression Lysate Product
GWB-CD4CF5 0.1 mg

IFI27L1 Over-expression Lysate Product

Sign In for Pricing
View Details
Retinoic acid (Tretinoin)
C07957-50mg 50 mg

Retinoic acid (Tretinoin)

Sign In for Pricing
View Details