Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lassa virus RING finger protein Z protein

This Lassa virus RING finger protein Z protein spans the amino acid sequence from region 2-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc-binding protein

UniProt

O73557

Expression Region

2-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human KCNMB1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 120UL
IRBAMLKCNMB1AP05120UL 120 µL

Rabbit Anti Human KCNMB1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 120UL

Sign In for Pricing
View Details
Anti-Human Exodus-2 - Biotin
RHF806B 50 µg

Anti-Human Exodus-2 - Biotin

Sign In for Pricing
View Details
Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)
MBS7010022-01 0.02 mg

Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)
MBS7010022-02 0.1 mg

Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)
MBS7010022-03 5x 0.1 mg

Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Human Neuropeptide S (NPS) Peptide
abx652330-01 1 mg

Human Neuropeptide S (NPS) Peptide

Sign In for Pricing
View Details