Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ITIH2 protein

This Bovine ITIH2 protein spans the amino acid sequence from region 1-50aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P56651

Expression Region

1-50aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHYQEVKWRKLGSYEHRLHLKPGRLAKHELEVFNGYFVHFPAPENMIPIG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BrdU Mouse Monoclonal Antibody [Clone ID: LBI3B2]
AMM08873VCF 100 µg

BrdU Mouse Monoclonal Antibody [Clone ID: LBI3B2]

Sign In for Pricing
View Details
CEPT1 (N-term) Rabbit Polyclonal Antibody
AP50865PU-N 400 µL

CEPT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PNMT Antibody
C45596-01 50 μL

PNMT Antibody

Sign In for Pricing
View Details
PNMT Antibody
C45596-02 100 µL

PNMT Antibody

Sign In for Pricing
View Details
Mouse Fabp3 (Fatty Acid Binding Protein 3, Muscle and Heart) ELISA Kit
FY-EM2857 96 Well

Mouse Fabp3 (Fatty Acid Binding Protein 3, Muscle and Heart) ELISA Kit

Sign In for Pricing
View Details
Fam161b (NM_172581) Mouse Untagged Clone
MC219459 10 µg

Fam161b (NM_172581) Mouse Untagged Clone

Sign In for Pricing
View Details