Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ITIH2 protein

This Bovine ITIH2 protein spans the amino acid sequence from region 1-50aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P56651

Expression Region

1-50aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHYQEVKWRKLGSYEHRLHLKPGRLAKHELEVFNGYFVHFPAPENMIPIG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)
MBS2111194 Inquire

Monoclonal Antibody to Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Brp44l ORF Vector (Mouse) (pORF)
13488014 1.0 µg DNA

Brp44l ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human ABLIM3 Knockout HEK293T cell line
GTR15404455 1 Vial

Human ABLIM3 Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-CD112/Nectin-2 (Rabbit, Monoclonal)
A102376 100 µL

Anti-CD112/Nectin-2 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Porcine Monocyte Chemotactic Protein 2 (MCP2) ELISA Kit
MBS453076-01 48 Tests

Porcine Monocyte Chemotactic Protein 2 (MCP2) ELISA Kit

Sign In for Pricing
View Details
Porcine Monocyte Chemotactic Protein 2 (MCP2) ELISA Kit
MBS453076-02 96 Tests

Porcine Monocyte Chemotactic Protein 2 (MCP2) ELISA Kit

Sign In for Pricing
View Details