Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TdnL protein

This tdnL protein spans the amino acid sequence from region 2-63aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4-oxalocrotonate tautomerase

UniProt

Q93JW0

Expression Region

2-63aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGVSAKELGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM5 Polyclonal Antibody
BT-AP07034-01 20 µL

PDLIM5 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM5 Polyclonal Antibody
BT-AP07034-02 50 µL

PDLIM5 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM5 Polyclonal Antibody
BT-AP07034-03 100 µL

PDLIM5 Polyclonal Antibody

Sign In for Pricing
View Details
CHP2 Antibody
orb670718-01 50 µg

CHP2 Antibody

Sign In for Pricing
View Details
CHP2 Antibody
orb670718-02 100 µg

CHP2 Antibody

Sign In for Pricing
View Details
CALD1 Antibody
CSB-PA004441DSR1HU-01 50 μL

CALD1 Antibody

Sign In for Pricing
View Details