Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TdnL protein

This tdnL protein spans the amino acid sequence from region 2-63aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4-oxalocrotonate tautomerase

UniProt

Q93JW0

Expression Region

2-63aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGVSAKELGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHD1 knockout cell line
ABC-KH3017 1 Vial

Human CHD1 knockout cell line

Sign In for Pricing
View Details
Adrenergic Receptor Alpha 1A (ADRa1A) BioAssayTM ELISA Kit (Human)
023162-01 48 Tests

Adrenergic Receptor Alpha 1A (ADRa1A) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Adrenergic Receptor Alpha 1A (ADRa1A) BioAssayTM ELISA Kit (Human)
023162-02 96 Tests

Adrenergic Receptor Alpha 1A (ADRa1A) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Brilliant Violet 605™ anti-human Ig light chain κ
GT16317 100 Tests

Brilliant Violet 605™ anti-human Ig light chain κ

Sign In for Pricing
View Details
Lysosome Associated Membrane Protein 2 (LAMP 2, Igp2, Igp110, CD107b, LAMP2C, LAMPB, Lysosome Associated Membrane Glycoprotein 2 Precursor, MAC3) (AP) discontinued
L9190-12E-AP 100 µL

Lysosome Associated Membrane Protein 2 (LAMP 2, Igp2, Igp110, CD107b, LAMP2C, LAMPB, Lysosome Associated Membrane Glycoprotein 2 Precursor, MAC3) (AP) discontinued

Sign In for Pricing
View Details
Tbc1d10a (NM_134023) Mouse Tagged ORF Clone
MR208025 10 µg

Tbc1d10a (NM_134023) Mouse Tagged ORF Clone

Sign In for Pricing
View Details