Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFB128 protein

This Human DEFB128 protein spans the amino acid sequence from region 19-93aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 28 Defensin, beta 128

UniProt

Q7Z7B8

Expression Region

19-93aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARLKKCFNKVTGYCRKKCKVGERYEIGCLSGKLCCANDEEEKKHVSFKKPHQHSGEKLSVLQDYIILPTITIFTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YWHAQP3 Recombinant Protein (Human)
RP108089 100 µg

YWHAQP3 Recombinant Protein (Human)

Sign In for Pricing
View Details
POU3F4 discontinued
531445-01 20 µL

POU3F4 discontinued

Sign In for Pricing
View Details
POU3F4 discontinued
531445-02 100 µL

POU3F4 discontinued

Sign In for Pricing
View Details
TPSAB1 Antibody Blocking peptide
orb1448958 500 µg

TPSAB1 Antibody Blocking peptide

Sign In for Pricing
View Details
Lentiviral mouse Zfp341 shRNA (UAS) - Lentiviral mouse Zfp341 shRNA (UAS, iRFP) (100)
GTR15245775 1 Vial

Lentiviral mouse Zfp341 shRNA (UAS) - Lentiviral mouse Zfp341 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
EB3 Antibody
orb622532-01 50 μL

EB3 Antibody

Sign In for Pricing
View Details