Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mip protein

This mip protein spans the amino acid sequence from region 21-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Rotamase

UniProt

P53605

Expression Region

21-233aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Legionella longbeachae

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAKGMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIPGWTEALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AATK Antibody (N-term)
MBS9207375-01 0.08 mL

AATK Antibody (N-term)

Sign In for Pricing
View Details
AATK Antibody (N-term)
MBS9207375-02 0.4 mL

AATK Antibody (N-term)

Sign In for Pricing
View Details
AATK Antibody (N-term)
MBS9207375-03 5x 0.4 mL

AATK Antibody (N-term)

Sign In for Pricing
View Details
KIAA1276 (FAM184B) (NM_015688) Human Over-expression Lysate
LS027146-20ug 20 µg

KIAA1276 (FAM184B) (NM_015688) Human Over-expression Lysate

Sign In for Pricing
View Details
PDIR Rabbit Polyclonal Antibody
orb556954 100 µL

PDIR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tween 20, 5l
2001-5l 5 L

Tween 20, 5l

Sign In for Pricing
View Details