Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KA3L protein

This KA3L protein spans the amino acid sequence from region 135-364aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P52539

Expression Region

135-364aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clec4a4 ORF Vector (Mouse) (pORF)
ORF041545 1.0 µg DNA

Clec4a4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
EFNB1 Protein Vector (Human) (pPM-C-His)
PV013696 500 ng

EFNB1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody
AP55344PU-N 100 µg

Transglutaminase 3 (TGM3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOL-DC/PEUL-100X30-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
324227 1 Label (1 Label (s) x 1 Pack)

SOL-DC/PEUL-100X30-1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
2'-O-Benzoylpaeoniflorin
orb1680880 5 mg

2'-O-Benzoylpaeoniflorin

Sign In for Pricing
View Details
B.P. Handle Scalpel #3
43230015-2 10 Each

B.P. Handle Scalpel #3

Sign In for Pricing
View Details