Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KA3L protein

This KA3L protein spans the amino acid sequence from region 135-364aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P52539

Expression Region

135-364aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC687575 siRNA Oligos set (Rat)
27426176 3x 5 nmol

LOC687575 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA), partial
MBS7070201 Inquire

Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA), partial

Sign In for Pricing
View Details
HIPK1 Antibody
MBS8517858-01 0.05 mg

HIPK1 Antibody

Sign In for Pricing
View Details
HIPK1 Antibody
MBS8517858-02 0.1 mg

HIPK1 Antibody

Sign In for Pricing
View Details
HIPK1 Antibody
MBS8517858-03 0.1 mL (AF750)

HIPK1 Antibody

Sign In for Pricing
View Details
HIPK1 Antibody
MBS8517858-04 0.1 mL (AF405M)

HIPK1 Antibody

Sign In for Pricing
View Details