Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U69 protein

This U69 protein spans the amino acid sequence from region 170-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P24446

Expression Region

170-355aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Field of Research

Developmental Biology, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAIKTANEDESVISAFIAGVIRAKSGADLLSHECVINNLLISNSVCMSHKVSLSRTYDIDLHKFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFLNHKKEIIFDAVLADYSLSEMHPNYNGTCAIAKEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)
TRV-0036438-01 20 µL

Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)

Sign In for Pricing
View Details
Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)
TRV-0036438-02 100 µL

Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)

Sign In for Pricing
View Details
Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)
TRV-0036438-03 200 µL

Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)

Sign In for Pricing
View Details
Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)
TRV-0036438-04 1 mL

Monoclonal Antibody to 2',5'-Oligoadenylate Synthetase 2 (OAS2)

Sign In for Pricing
View Details
ASMTL (NM_001173474) Human Untagged Clone
SC328973 10 µg

ASMTL (NM_001173474) Human Untagged Clone

Sign In for Pricing
View Details
Rat Family With Sequence Similarity 168, Member B (FAM168B) ELISA Kit
abx522837 96 Tests

Rat Family With Sequence Similarity 168, Member B (FAM168B) ELISA Kit

Sign In for Pricing
View Details