Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U69 protein

This U69 protein spans the amino acid sequence from region 170-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P24446

Expression Region

170-355aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

Field of Research

Developmental Biology, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAIKTANEDESVISAFIAGVIRAKSGADLLSHECVINNLLISNSVCMSHKVSLSRTYDIDLHKFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFLNHKKEIIFDAVLADYSLSEMHPNYNGTCAIAKEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD6 Human shRNA Lentiviral Particle (Locus ID 84674)
TL305649V 500 µL Each

CARD6 Human shRNA Lentiviral Particle (Locus ID 84674)

Sign In for Pricing
View Details
Porcine MMP-1 ELISA Kit
EPM0301 96 Tests

Porcine MMP-1 ELISA Kit

Sign In for Pricing
View Details
Phrf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
36615116 3x 1.0 µg

Phrf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
WM-1-4-PK Adhesive-backed Marker Combination Packs
111838 900 Pack (36 Label (s) x 25 Card)

WM-1-4-PK Adhesive-backed Marker Combination Packs

Sign In for Pricing
View Details
Lithium carbonate
13183442-01 100 g

Lithium carbonate

Sign In for Pricing
View Details
Lithium carbonate
13183442-02 500 g

Lithium carbonate

Sign In for Pricing
View Details