Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U100 protein

This U100 protein spans the amino acid sequence from region 25-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein 105 Glycoprotein Q-80k HCLF1 protein

UniProt

Q9QJ11

Expression Region

25-354aa (X130S, X223S)

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Field of Research

Developmental Biology, Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF5 Rabbit Polyclonal Antibody
orb624821-01 50 µg

ARF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARF5 Rabbit Polyclonal Antibody
orb624821-02 100 µg

ARF5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NAD Synthetase Rabbit Polyclonal Antibody (Cy5.5)
orb1074190 100 µL

NAD Synthetase Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
MTF1 Recombinant Protein (Mouse)
RP152021 100 µg

MTF1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
DCPS Antibody (YA8668, Mouse)
HY-P88984 1 Each

DCPS Antibody (YA8668, Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Mdm4 shRNA (UAS) - Lentiviral mouse Mdm4 shRNA (UAS, RFP) (25)
GTR15190307 1 Vial

Lentiviral mouse Mdm4 shRNA (UAS) - Lentiviral mouse Mdm4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details