Hmw1 protein
This hmw1 protein spans the amino acid sequence from region 1-139aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cytadherence accessory protein 1
UniProt
Q50365
Expression Region
1-139aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Field of Research
Cardiovascular Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKKSKEAVFEDKDYTEENPEQIFGNLYDGKLTVQDGKVKIAYDGDGNGYYIAFNSETGVYYDPYGDTEYDISVLFDANGNSFVFADAPTVEVLAGEQEQTEAEPDYLQYVGNEAYGYYDEAGEWVWSGY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC743066-100 1x 100 µL
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681527-500 1x 500 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PE/Cyanine7 Anti-Mouse CD122/IL-2RB Antibody[5H4]](https://cdn.genprice.uk/products/763/68dd149c061270361e7cf2b5/imageurl/e-ab-f1029uh.webp)
E-AB-F1029UH-01 25 µg
PE/Cyanine7 Anti-Mouse CD122/IL-2RB Antibody[5H4]
Sign In for Pricing
View Details E-AB-F1029UH-02 100 µg
PE/Cyanine7 Anti-Mouse CD122/IL-2RB Antibody[5H4]
Sign In for Pricing
View Details