Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Firefly resilin protein

This Firefly resilin protein spans the amino acid sequence from region 342-620aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9V7U0

Expression Region

342-620aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PAKYEFNYQVEDAPSGLSFGHSEMRDGDFTTGQYNVLLPDGRKQIVEYEADQQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADGYSSGRPGNGNGNGNGGYSGGRPGGQDLGPSGYSGGRPGGQDLGAGGYSNGKPGGQDLGPGGYSGGRPGGQDLGRDGYSGGRPGGQDLGASGYSNGRPGGNGNGGSDGGRVIIGGRVIGGQDGGDQGYSGGRPGGQDLGRDGYSSGRPGGRPGGNGQDSQDGQGYSSGRPGQGGRNGFGPGGQNGDNDGSGYRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP-724714
S1167-25mg 25 mg

CP-724714

Sign In for Pricing
View Details
Phospho-MAPKAPK5 (Thr182) Rabbit Polyclonal Antibody
orb7092-01 50 μL

Phospho-MAPKAPK5 (Thr182) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-MAPKAPK5 (Thr182) Rabbit Polyclonal Antibody
orb7092-02 100 µL

Phospho-MAPKAPK5 (Thr182) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-MAPKAPK5 (Thr182) Rabbit Polyclonal Antibody
orb7092-03 200 µL

Phospho-MAPKAPK5 (Thr182) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CETP Human Over-expression Lysate
orb1341581 100 µg

CETP Human Over-expression Lysate

Sign In for Pricing
View Details
RHBDL2 (Rhomboid-like Protein 2, Rhomboid-related Protein 2, RRP2) (HRP)
132546-HRP 100 µL

RHBDL2 (Rhomboid-like Protein 2, Rhomboid-related Protein 2, RRP2) (HRP)

Sign In for Pricing
View Details