Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli nudC protein

This E. coli nudC protein spans the amino acid sequence from region 1-257aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8X6X7

Expression Region

1-257aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLIQQQRRYDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKHLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit
MBS9344505-01 48 Well

Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit

Sign In for Pricing
View Details
Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit
MBS9344505-02 96 Well

Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit

Sign In for Pricing
View Details
Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit
MBS9344505-03 5x 96 Well

Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit

Sign In for Pricing
View Details
Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit
MBS9344505-04 10x 96 Well

Rat ADP Ribosyltransferase 3 (ART3) ELISA Kit

Sign In for Pricing
View Details
FOXA1 Knockout 22RV1 Cell Line
ARG0007 1 Million

FOXA1 Knockout 22RV1 Cell Line

Sign In for Pricing
View Details
Human NIT1 ELISA Kit
E026631 1 Each

Human NIT1 ELISA Kit

Sign In for Pricing
View Details