Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIZ1 protein

This SIZ1 protein spans the amino acid sequence from region 1-171aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 SUMO-protein transferase SIZ1

UniProt

Q680Q4

Expression Region

1-171aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTVAKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGAT1 Recombinant Protein (Mouse)
RP128837 100 µg

DGAT1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Cassette2.5m2, 8kd
CSTPSUGG00080250 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

Cassette2.5m2, 8kd

Sign In for Pricing
View Details
Lentiviral mouse Srp19 shRNA (UAS) - Lentiviral mouse Srp19 shRNA (UAS, iRFP) plasmid
GTR15192976 1 Vial

Lentiviral mouse Srp19 shRNA (UAS) - Lentiviral mouse Srp19 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Polymeric Immunoglobulin Receptor (PIGR)
MBS2051256-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Polymeric Immunoglobulin Receptor (PIGR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Polymeric Immunoglobulin Receptor (PIGR)
MBS2051256-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Polymeric Immunoglobulin Receptor (PIGR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Polymeric Immunoglobulin Receptor (PIGR)
MBS2051256-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Polymeric Immunoglobulin Receptor (PIGR)

Sign In for Pricing
View Details