Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human coronavirus 229E Nucleo protein

This Human coronavirus 229E Nucleo protein spans the amino acid sequence from region 1-389aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P15130

Expression Region

1-389aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human coronavirus 229E (HCoV-229E)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)
abx336893-01 20 µg

OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)

Sign In for Pricing
View Details
OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)
abx336893-02 50 µg

OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)

Sign In for Pricing
View Details
OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)
abx336893-03 100 µg

OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)

Sign In for Pricing
View Details
OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)
abx336893-04 200 µg

OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)

Sign In for Pricing
View Details
OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)
abx336893-05 1 mg

OTU Deubiquitinase 7B (OTUD7B) Antibody (FITC)

Sign In for Pricing
View Details
Ccl4, Recombinant, Mouse (C-C Motif Chemokine 4, Immune Activation Protein 2, ACT-2, ACT2, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Protein H400, SIS-gamma, Small-inducible Cytokine A4, Mip1b, Scya4)
149680-01 2 µg

Ccl4, Recombinant, Mouse (C-C Motif Chemokine 4, Immune Activation Protein 2, ACT-2, ACT2, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Protein H400, SIS-gamma, Small-inducible Cytokine A4, Mip1b, Scya4)

Sign In for Pricing
View Details