Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human coronavirus 229E Nucleo protein

This Human coronavirus 229E Nucleo protein spans the amino acid sequence from region 1-389aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P15130

Expression Region

1-389aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human coronavirus 229E (HCoV-229E)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POMT1 shRNA Plasmid
abx957203-01 150 µg

Human POMT1 shRNA Plasmid

Sign In for Pricing
View Details
Human POMT1 shRNA Plasmid
abx957203-02 300 µg

Human POMT1 shRNA Plasmid

Sign In for Pricing
View Details
Human PHOX2A Pre-designed siRNA Set B
SI012117B 1 Each

Human PHOX2A Pre-designed siRNA Set B

Sign In for Pricing
View Details
CCR4 Human Recombinant Protein, Virus-like Particle
TP721389 50 µg

CCR4 Human Recombinant Protein, Virus-like Particle

Sign In for Pricing
View Details
ANXA8 (Annexin A8, Annexin-8, Annexin VIII, Vascular Anticoagulant-beta, VAC-beta, ANX8) discontinued
A2295-15X1 100 µg

ANXA8 (Annexin A8, Annexin-8, Annexin VIII, Vascular Anticoagulant-beta, VAC-beta, ANX8) discontinued

Sign In for Pricing
View Details
Human ABT1 shRNA Plasmid
abx959224-01 150 µg

Human ABT1 shRNA Plasmid

Sign In for Pricing
View Details