Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RHOD protein

This Human RHOD protein spans the amino acid sequence from region 1-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rho-related protein HP1

UniProt

O00212

Expression Region

1-207aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), 0.2mg/mL
BNUB1786-500 1x 500 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), 0.2mg/mL

Sign In for Pricing
View Details
WDR18 Polyclonal Antibody
E-AB-66609-01 60 µL

WDR18 Polyclonal Antibody

Sign In for Pricing
View Details
WDR18 Polyclonal Antibody
E-AB-66609-02 120 µL

WDR18 Polyclonal Antibody

Sign In for Pricing
View Details
WDR18 Polyclonal Antibody
E-AB-66609-03 200 µL

WDR18 Polyclonal Antibody

Sign In for Pricing
View Details
EDC4 Polyclonal Antibody
E-AB-66481-01 60 µL

EDC4 Polyclonal Antibody

Sign In for Pricing
View Details
EDC4 Polyclonal Antibody
E-AB-66481-02 120 µL

EDC4 Polyclonal Antibody

Sign In for Pricing
View Details