Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3L protein

This H3L protein spans the amino acid sequence from region 21-270aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q1M2A5

Expression Region

21-270aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYKDYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEYVVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHDPRLVAEHRFENMKPNFWSRIGTAAAKRYPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPLX1 Rabbit Polyclonal Antibody (BF350)
orb2545303 100 µL

CPLX1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit
MBS7235389-01 48 Well

Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit

Sign In for Pricing
View Details
Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit
MBS7235389-02 96 Well

Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit

Sign In for Pricing
View Details
Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit
MBS7235389-03 5x 96 Well

Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit

Sign In for Pricing
View Details
Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit
MBS7235389-04 10x 96 Well

Human Cell division cycle 7 related protein kinase (CDC7) ELISA Kit

Sign In for Pricing
View Details
DRAM1 Polyclonal Conjugated Antibody
MBS9440580-01 0.1 mL (Biotin)

DRAM1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details