Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Varicella-zoster virus Envelope glycoprotein protein

This Varicella-zoster virus Envelope glycoprotein protein spans the amino acid sequence from region 22-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P09308

Expression Region

22-159aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLAQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFDN5 Polyclonal Antibody, FITC Conjugated
A51515 100 µg

PFDN5 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
DMRT1 siRNA (Mouse)
MBS8227834-01 15 nmol

DMRT1 siRNA (Mouse)

Sign In for Pricing
View Details
DMRT1 siRNA (Mouse)
MBS8227834-02 30 nmol

DMRT1 siRNA (Mouse)

Sign In for Pricing
View Details
DMRT1 siRNA (Mouse)
MBS8227834-03 5x 30 nmol

DMRT1 siRNA (Mouse)

Sign In for Pricing
View Details
PPAR alpha (PPARA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E8]
TA503540BM 100 µL

PPAR alpha (PPARA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E8]

Sign In for Pricing
View Details
N- (4-Aminobenzoyl) -L-glutamic Acid (hydrate)
T37998-01 1 g

N- (4-Aminobenzoyl) -L-glutamic Acid (hydrate)

Sign In for Pricing
View Details