Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hfe protein

This Mouse Hfe protein spans the amino acid sequence from region 25-359aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P70387

Expression Region

25-359aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ythdf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50636116 3x 1.0 µg

Ythdf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PTP-PEST (H-11) PE
sc-271351 PE 200 µg/mL

PTP-PEST (H-11) PE

Sign In for Pricing
View Details
DHRS2 Overexpression Lysate (Native) - (Dry Ice)
NBP2-04800 0.1 mg

DHRS2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
SNX16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2255005 3x 1.0 µg

SNX16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
BMPR-II rabbit pAb
E44H16417 100 µL

BMPR-II rabbit pAb

Sign In for Pricing
View Details
Yuanhunine
EEA38715-01 0.5 mg

Yuanhunine

Sign In for Pricing
View Details