Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Herpesvirus 6B Protein U22 protein

This herpesvirus 6B Protein U22 protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9QJ44

Expression Region

1-202aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVPQGWSLAWVSVLYVSVIPSLHIINNENSVFIGTHSETELRHWLIFVKMAQRSGTAWWRMASVPINAYFERDIAFLFNPRCVIETALGSKILCRYNKNIGVVFVDNDTTCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRKERRRFLPRYERFVYYCISVYLFAVAVFCSCWFALDPLFNMWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WEE2 antibody
PAab09506 100 µg

Anti-WEE2 antibody

Sign In for Pricing
View Details
CHCHD1 Rabbit Polyclonal Antibody (APC)
orb996884 100 µL

CHCHD1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Fmoc-(Hmb)Gly-OH
B-3490.0005 5.0g

Fmoc-(Hmb)Gly-OH

Sign In for Pricing
View Details
PTPRCAP Double Nickase Plasmid (m)
sc-422518-NIC 20 µg

PTPRCAP Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Benzobicyclon
TRC-B366140-100MG 100 mg

Benzobicyclon

Sign In for Pricing
View Details
PE anti-human CD159a (NKG2A)
GT15525 100 Tests

PE anti-human CD159a (NKG2A)

Sign In for Pricing
View Details