Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AMELX protein

This Human AMELX protein spans the amino acid sequence from region 17-191aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q99217

Expression Region

17-191aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P73 discontinued
346944-01 100 µL

P73 discontinued

Sign In for Pricing
View Details
P73 discontinued
346944-02 200 µL

P73 discontinued

Sign In for Pricing
View Details
Rabbit Brain Fibroblast Complete Medium
CM-Rb109-01 100 mL

Rabbit Brain Fibroblast Complete Medium

Sign In for Pricing
View Details
Rabbit Brain Fibroblast Complete Medium
CM-Rb109-02 4x 125 mL

Rabbit Brain Fibroblast Complete Medium

Sign In for Pricing
View Details
Anti-LGALS3 Antibody (1V601)
TMAC-01600-01 50 μL

Anti-LGALS3 Antibody (1V601)

Sign In for Pricing
View Details
Anti-LGALS3 Antibody (1V601)
TMAC-01600-02 100 µL

Anti-LGALS3 Antibody (1V601)

Sign In for Pricing
View Details