Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP14 protein

This Human PARP14 protein spans the amino acid sequence from region 1605-1801aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 8 B aggressive lymphoma protein 2 Poly [ADP-ribose] polymerase 14

UniProt

Q460N5

Expression Region

1605-1801aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP1 discontinued
541590-01 30ul

RAP1 discontinued

Sign In for Pricing
View Details
RAP1 discontinued
541590-02 100 µL

RAP1 discontinued

Sign In for Pricing
View Details
Ramos Lysate
1225 0.1 mg

Ramos Lysate

Sign In for Pricing
View Details
ESR1 Knockout A549 Polyclonal Cells
ARG10987 1 Million

ESR1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Abcb6 Mouse shRNA Plasmid (Locus ID 74104)
TR517121 1 Kit

Abcb6 Mouse shRNA Plasmid (Locus ID 74104)

Sign In for Pricing
View Details
Mouse Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
BSKM64946-01 48 Tests

Mouse Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details